SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005192 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005192
Domain Number 1 Region: 28-93
Classification Level Classification E-value
Superfamily UBA-like 0.000000442
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005192   Gene: ENSMODG00000004216   Transcript: ENSMODT00000005304
Sequence length 290
Comment pep:known_by_projection chromosome:BROADO5:8:28026361:28149007:1 gene:ENSMODG00000004216 transcript:ENSMODT00000005304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKQNQKDPSGFIFDLQSNTVLAQGGTFENMKEKINAVRAIVPNRSNNEIILVLQHFDN
CVDKTVQAFMEGNASEVLKEWTITGKKKNKKKKSKPKPAAEASNNLPDTNKLASTQEEQS
AASLDKGGINGYHVNGAANDTESVDSLSEGLEILSIDARELEDSESAIPDMSDRTVSMLE
NGVSDFESKSLIMNATQTSQQSLKHESRNPTKSLSRPIPGSQFSSLGSLSTIEDVPLSST
NKKLGSNIEKSVKDLQRCTVSLARYRVVVKEEMDASIKKMKQAFAELQSW
Download sequence
Identical sequences F6XQE9
XP_007502961.1.35504 ENSMODP00000005192 ENSMODP00000005192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]