SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005193 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005193
Domain Number 1 Region: 176-279
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-22
Family Canonical RBD 0.00000263
Further Details:      
 
Domain Number 2 Region: 53-136
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.78e-19
Family Canonical RBD 0.00000772
Further Details:      
 
Domain Number 3 Region: 329-420
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.37e-19
Family Canonical RBD 0.0000332
Further Details:      
 
Domain Number 4 Region: 442-530
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000215
Family Canonical RBD 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005193   Gene: ENSMODG00000004211   Transcript: ENSMODT00000005305
Sequence length 532
Comment pep:known_by_projection chromosome:BROADO5:2:462205572:462346025:1 gene:ENSMODG00000004211 transcript:ENSMODT00000005305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGIVTDVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRV
LHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEESAITMVNYYSAVTPH
LRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPV
LRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDG
QNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSL
LAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFG
VYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPRE
GLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGG
TVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI
Download sequence
Identical sequences F6XQE0
ENSMODP00000005193 ENSMODP00000005193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]