SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005396 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005396
Domain Number 1 Region: 257-286
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0000209
Family Moesin tail domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005396   Gene: ENSMODG00000004378   Transcript: ENSMODT00000005513
Sequence length 289
Comment pep:known_by_projection chromosome:BROADO5:4:162087391:162095392:-1 gene:ENSMODG00000004378 transcript:ENSMODT00000005513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVSKETSLTECNGDVSPEKEITEISDEVFTSDGLSKYHDTDVNPEDSFSEGNLDENKY
SRASMICRDLAWSLEEDKHREEDFTVHKRIASLSLKETRAGEMTSEEGLQWEKIPPYGKV
QETTRLKKSGTEKLLEERDGGIRGNEEFQVAEMEDNLEWLGSQQPRKDAMMTKQDKEVED
GEQEIDNDNEDGGDDDDDDDEEEDEVRLIEFKKGNGRASHFKEEGNVSEDSPLSSPNSQP
ITPEELPALGKKNDISRHTYSRYNTISYRKIKKGNTKQRIDEFESMLHL
Download sequence
Identical sequences F6VTK3
ENSMODP00000005396 ENSMODP00000005396 XP_001373459.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]