SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005437 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005437
Domain Number 1 Region: 59-189
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-37
Family Regulator of G-protein signaling, RGS 0.00013
Further Details:      
 
Domain Number 2 Region: 358-459
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.24e-30
Family Ras-binding domain, RBD 0.00016
Further Details:      
 
Domain Number 3 Region: 303-371
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.99e-19
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005437   Gene: ENSMODG00000004413   Transcript: ENSMODT00000005554
Sequence length 576
Comment pep:known_by_projection chromosome:BROADO5:1:383341058:383371534:-1 gene:ENSMODG00000004413 transcript:ENSMODT00000005554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKAKHLGVPNGRMVLAVSDGELSSVVGPEGAGEGRGSTLSVHSLPSGPSSPFTPEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENLSFWKACEQFQQIPASDTQQLAREARC
IYEEFLSSQALSPVNIDRQAWLGEEVLATPNPDMFRVQQLQIFNLMKFDSYARFVKSPMY
RECLLAEAEGRPLCEPGTSDPGSPNTTSRKVPVRGGKVWPLRVLTDLPLALPFSQSESTT
SLFPSELGATNGNPALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGGTEGEGENRV
GRYCCVYLPDGTASLALVRPGLTIRSMLASICEKRGLSLPDIKVYLVGNEQKALVLDQDC
MVLADQEVKLENRINFELEITALGKVVRITSKSSKRLREALLPILGKHGLSLQQISVHLS
GEKRTLDLEKLVSSVSAQRLVLDTLPGVKILKTESTSSSQSQGGPLQMEGKTSQPPSLLT
NSLAEGPRSTGKRHTCDIEGLVELLNRVQSSRADDQRGLLRKEDLVLPDFLQLPSQEPSL
SEEQPHSQAPQSHLPQTEPPAPAQGDPADSSTSHAL
Download sequence
Identical sequences F6SV26
ENSMODP00000005437 ENSMODP00000005437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]