SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005475 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005475
Domain Number 1 Region: 38-171
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.28e-33
Family Canonical RBD 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005475   Gene: ENSMODG00000004445   Transcript: ENSMODT00000005593
Sequence length 435
Comment pep:known_by_projection chromosome:BROADO5:X:69964961:69971746:-1 gene:ENSMODG00000004445 transcript:ENSMODT00000005593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPPIPANGQQANSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEK
YGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLP
QFVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLT
TFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIE
MEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQK
RKQMELRQEEERRRREEEMRRQQEEMMRRQQEGFKGNFPDAREQEMRMGQMGIGGAMGLN
NRGSLGGANVPAGAPSAPGPGPMMPDGTMGMTPPPSDRFGQGGTMEGLGAMGANPPAFNR
GTPGGDFGPNKRRRY
Download sequence
Identical sequences F6RSW7
ENSMODP00000005475 13616.ENSMODP00000005475 ENSMODP00000005475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]