SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005523 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005523
Domain Number 1 Region: 241-441
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.00000000597
Further Details:      
 
Domain Number 2 Region: 433-557
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-35
Family Pleckstrin-homology domain (PH domain) 0.0000134
Further Details:      
 
Domain Number 3 Region: 165-235
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-25
Family SH3-domain 0.0000434
Further Details:      
 
Domain Number 4 Region: 2-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.24e-24
Family Calponin-homology domain, CH-domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005523
Domain Number - Region: 739-795
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0196
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005523   Gene: ENSMODG00000004481   Transcript: ENSMODT00000005641
Sequence length 803
Comment pep:known_by_projection chromosome:BROADO5:7:80877809:81262353:-1 gene:ENSMODG00000004481 transcript:ENSMODT00000005641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQSSLKDGVVLCRLLDRLLPGTIEKVYPEP
RSESECLSNIREFLRGCGSSLRLETFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDS
VCARPSSHRIKSFDSLGSQSLLSRTSKLFQGQYRSLDMTDNSNHQLVVRAKFNFQQTNED
ELSFTKGDIIHVTRVEEGGWWEGTHNGKTGWFPSNYVREIKSNEKPVSPKSGALKSPPKG
FDTSAINKSYYNVVLQNILETENEYSKELQTILSTYLRPLQSSEKLNSTNILYLMGNLEE
ISSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLAYCANHPSAVNVLTEHSED
LGEFMEMKGANSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAF
KNLSAQCQEVRKRKELELQILTEAIRCWEGDDIKTLGNVIYMSQVMIQCAGNEEKNERYL
LLFPNILLMLSASPRMSGFIYQGKLPMTGTTITKLEDTENHKNAFEIAGSMIERILVSCN
NQQDLHEWVDHLQKQTKVTTIGNPTIKPHSVPSHTLPSHPITPSSKHSDSKPVPLTPAYH
TLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMK
KLLPKRKPERKPSDEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESAPQ
VLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARK
DLEKLVRKVLKNMNDPAWDETNL
Download sequence
Identical sequences F6VRF8
ENSMODP00000005523 ENSMODP00000005523 XP_007501346.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]