SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005593 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005593
Domain Number 1 Region: 165-276
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.22e-25
Family Canonical RBD 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005593
Domain Number - Region: 117-148
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0811
Family Mitotic arrest deficient-like 1, Mad1 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005593   Gene: ENSMODG00000004535   Transcript: ENSMODT00000005712
Sequence length 304
Comment pep:novel chromosome:BROADO5:1:172705010:172710212:1 gene:ENSMODG00000004535 transcript:ENSMODT00000005712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEPGEGAPGGAGDYGNGLEAEELEPEEL
LLEPEPEPEPEEEPPRPRAPPGASGPGPGAGAPGSQEEEEEPGLVEGDPGDGAIEDPELE
AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKDSVRTSMALDDSLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARATNYSSSRSRFYSGFNSRPRGRVYRGRARAT
SWFL
Download sequence
Identical sequences F6U9B0
ENSMODP00000005593 ENSMODP00000005593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]