SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005596 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005596
Domain Number 1 Region: 4-220
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.95e-36
Family Methenyltetrahydrofolate synthetase 0.0053
Further Details:      
 
Domain Number 2 Region: 296-379
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000019
Family Canonical RBD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005596   Gene: ENSMODG00000004537   Transcript: ENSMODT00000005715
Sequence length 380
Comment pep:known_by_projection chromosome:BROADO5:1:691515935:691581468:-1 gene:ENSMODG00000004537 transcript:ENSMODT00000005715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGISKQEIREKIWDYMEAQNIADFPRPVHHRIPNFKGSYEACQNIRELDAYSRMQEVKVD
PDKPLEGVRLMVLQGRKTLLVPTPRLRTGLFNKIVPPPGATKEILRRCATSQGVKNYSVP
IGLDSRIIVDLIVVGSVAVSEKGWRIGKGEGYADMEYAMMVSMGAVREKTPVVTIVHDCQ
VVDVPEELLGDHDLTVDYILTPTRVIVTGCTRPKPQGIIWSMISEEMMGRIPILKNLHFR
EKQAGKDVTLQKEYLEHSKTSNKQAVLWKSDQIASTTLSELAGSAHLDHDPVALKNESSS
SVTTVYVGNIPQDARVSDMKRTLREYNAVPLRLNWQGPQGRAFLDYKDQATAECVISSLK
GLSFGGNSLWVKLAKKQKNK
Download sequence
Identical sequences F6U963
13616.ENSMODP00000005596 ENSMODP00000005596 ENSMODP00000005596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]