SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005696 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005696
Domain Number 1 Region: 84-339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-97
Family Protein kinases, catalytic subunit 0.00000973
Further Details:      
 
Domain Number 2 Region: 712-821
Classification Level Classification E-value
Superfamily KA1-like 1.96e-47
Family Kinase associated domain 1, KA1 0.00000569
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005696
Domain Number - Region: 349-397
Classification Level Classification E-value
Superfamily UBA-like 0.003
Family UBA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005696   Gene: ENSMODG00000004622   Transcript: ENSMODT00000005816
Sequence length 821
Comment pep:known_by_projection chromosome:BROADO5:2:130973779:131137666:1 gene:ENSMODG00000004622 transcript:ENSMODT00000005816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARTPLPTVNERDTENSLKWCGNKNTKFLTSNDCLVGETAYYMHTSVDGYPEPHIQPTK
SSSRQNIPRCRNSITSSTDEQPHIGNYRLLKTIGKGNFAKVKLARHVLTGREVAVKIIDK
TQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGR
MKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDADMNIKIADFGFSNEFTIGNKL
DTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGK
YRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPEPDFNDT
KRIDIMVTMGFSRDEINVSLINQKYDEVMATYLLLGRKPPEFEGSESLSSGNLCQRSRPS
SDLNNSSMQSPAHLKVQRSISANQKQRRFSDHVGPTIPAAVSYTKRAQANSAESEQKEEW
DKDVSHKLGSTIVGSKAEMTASPLVGPERKKSSTMPSNNAFSGTGMTRRNTYVCERTTDR
YSAIQNGKDSSLTEMSATSTSSAGSAITSAAPSTRPRHQKSMSASGHPIKVTLPTIKDGT
DYRPGTTQRVPAASPSAHSISATTPDRTRFPRGSSSRSTFHGEQLRERRNATYNGPPASP
SHETGTFSHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKEREKEDSKD
SKPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKEKFLLFCVHGDARQDSLVQ
WEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences F6XLB8
ENSMODP00000005696 ENSMODP00000005696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]