SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005883 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005883
Domain Number 1 Region: 523-761
Classification Level Classification E-value
Superfamily Ras GEF 1.28e-35
Family Ras GEF 0.01
Further Details:      
 
Domain Number 2 Region: 140-258
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-25
Family SH2 domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005883   Gene: ENSMODG00000004777   Transcript: ENSMODT00000006007
Sequence length 826
Comment pep:known_by_projection chromosome:BROADO5:2:458172499:458345082:-1 gene:ENSMODG00000004777 transcript:ENSMODT00000006007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGKFASLPRNMQVNHQFPLASSMDLLSSKSPLAEPRSDAYQDVSIHGTLPRKKKGALP
IKSSDAFSHMGTFPYSKTQRQNSPLIQDVIEESPLQDWRGEKSAFRDPHLLDPMMEYVKF
SKERHIMDRNPERLLKKELEEELQLSGEDLRSHAWYHGRIPRQVSESLVQRDGDFLVRDS
LSSPGNFVLTCQWKNTAQHFKISKTILRLNEAYCRIQYQFDQESFDTIPGLVRCYVGNRR
PISQQSGAIIFQPINRTVPLRCLEERYGSSPARSRDCSLSEGKIETTKRLSLNMCNVPSR
EQSLARGNLLRNKEKSGSQPACLDHMQEKRSLSLKAHQSESYLPIGSKLPPQSPGVDTNP
CPNSPVFRTGSEPTLSPTVVRRVSLESQVPGEALRGSDSQLYPKPPPKPSKVPFLKPPPS
PSTWHNFEANYCELNPAFPPGYCGTKQALCPQSGCGEPLTAKENGALSHRNSGTNYLILD
DDAPRSSRALLAAQMEKGQEDGGVFVTPCLETVSSFRPNDFESKLLPPENKPLETSMLKR
AKELFTNNDPKVIAKHMLKMDCKVARILEVSEEMKRIMGVNSGLELITLPYGHQLRLDII
ERHNTMAIGIAVDVLGCTGSLEERAATLHKIIRVAVELKDSMGDLYAFSAIMKALEMPQI
TRLDQTWTALRHHYTQTAILYEKQLKPFSKSLHEGKETMCVPPNKVTVPLLMPLVTLMER
QVVTFEGTDMWEKNDQSCEIMLSHLETARFVAQAADTYRANAERILEGFQADEEMNEIFK
TEFQMRLLWGSKGAQVNQSERYEKFNQILTALSRKLEPPPMKHAEL
Download sequence
Identical sequences F6WK76
ENSMODP00000005883 XP_001372040.1.35504 XP_007485051.1.35504 ENSMODP00000005883 13616.ENSMODP00000005883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]