SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005891 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005891
Domain Number 1 Region: 301-448
Classification Level Classification E-value
Superfamily SET domain 3.01e-27
Family Histone lysine methyltransferases 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005891
Domain Number - Region: 89-136
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0064
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005891   Gene: ENSMODG00000004781   Transcript: ENSMODT00000006015
Sequence length 1484
Comment pep:known_by_projection chromosome:BROADO5:6:242333680:242373041:1 gene:ENSMODG00000004781 transcript:ENSMODT00000006015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLRDPIKKNSSESKPAQSGFSRGNSPLSCPESVEASPAVCEKNVYSTHNYGTAQRHGY
RGLPYADHNYGAPPPPTPPASPPVQTIIPHAELNGLHSPDEENSGDSESSEGESIPTWCH
CGLSQDGFLLKCDKCRGMSRGKVIRLHRRKQDNVSGGDSSATESWDEELSPSTVLYTATQ
HTPTSITLTVNRVRRTKPKKRKKSPEKGRTAPKTKKIKAFREGSRKSLRMKNSPSEAHAL
DENTTEGWENRIRLWTDQYEEAFTNQYSADVQNLLERHLNSSKEFVGKAAVLDTINKTEL
ACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFF
KKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRHMIADGMIHLCIYAASA
ITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQRRNPNAAADPPPPPPLSLLSIGAE
TRRRKARRKELEMEQQNDVLDESSNQQPEEAPEGVTVASDNEDIDNPEEKLEEDTEETVD
DQGILGPNRRSREERKVEAIMHMFENLEKRKRRREQPLERGRLDIEVTPGSEVPVLEESK
TESSEPEDRNSAFSVPAPGPPNNMGVNTRRSAQAGDTVAEKPVIKPTPSRPSRPRPKSRI
SRYRTSSAQRLKRQKQANSQQVELSQVLLDEGGNGNSVTPAEVGSVDNIGENRPLTGSDP
AVVLAAGTQVNRAVFKYPKTKKYLVTEWLNDKAEKHECPVECPLRITTDPTVLATTLNML
PGLVHSPLICTTPKHYIRFGSPFIPERRRRPLLLDGTFSSCKKRWMKQALEEGMTQTSSV
PQESRIQHLYQSNENSNSSSICKDNADLLSPLKKWKSRYLMEQNVTKLLRPLSPITPPPP
IPSIPSSQSPQLTVPCSTLPGEEECRNGYGLMFSPIPSLATSRCNTPLQFELGLRTDLDM
AKVGYLEPNTNNCLERQVLLNSGQSDLVSQPSIPSTSDSSHQGNNGDGQQTLLRNSDQAF
RTEFNLMYAFSPLNAMPRADGLLRGSPLVGDRKHLNSDARYCSSPAEGYSSRHEHGLIKD
ISRGSMSPGGEKASDGVKPAPQNPPQRKKATVSLLEYRKRKQEAKENSLNLVGDSVRCTG
TPSRQGSNSSVSDTETFGVQGSLARAPSSPHRGFSPSHSSVPPVDDISPTDPRGTTSSHC
RPQENISSRWMVPTSVERLREGRGILKKVLRSSSVKVSQKEETSPAWESTTEKESDPTEG
EGPEMTSSALSKGSAVYSPSRYSYQLLQCDSPRTESQSLLQQSSSPFKGHPTQSPGYSYR
TAALRSGNTPSHSSSESSLSSTSYSSPAHSAPTDSLGLFAGTPGYYNSQPHCGSSSIQKR
SCPSTAASPPLQGPSDSSLPSDSVSQSSTGTWSSTSFPPNSRSLPSDLRTISLPGSGQSA
AFQTSRVSTVSNSQHYPHRGGEGVHPYRLQQLQGSGVKTQTGLS
Download sequence
Identical sequences F6WJG5
ENSMODP00000005891 ENSMODP00000005891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]