SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005960 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005960
Domain Number 1 Region: 335-450
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-21
Family SH2 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005960   Gene: ENSMODG00000004839   Transcript: ENSMODT00000006084
Sequence length 466
Comment pep:novel chromosome:BROADO5:1:75170106:75289131:1 gene:ENSMODG00000004839 transcript:ENSMODT00000006084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLNRIAVPAGQKLRQLQKIVHGITNNEGGIMNKFKKLKNKAPPSVPQRDYVSESPVDE
EEQWSDDFDSDYENPDEPSDSETYVVPGEETADDSYEPPPTEKEKKKLPTALPFSKGEYA
DNRSHQRHSPPFSKTLPDKASWPSQKTRNSSLQADYVVPVEDEDENYIHPTESNSPSSEY
APKVNRSVKPSSSTSPNPLPPVPALAPEMYEIPVSETSSFSPYQKPSVKTHDSSHATAWE
PKSPSSIQAPSPLPRALKKTPTQLKTAPGLPPQNTWSDHEEKPIPAERHRGRVPGQRLEH
RQQPPFPTVNKPVQQKPVPPPKPPEVLSSSMDIPLPSFPANSCLSDQEAEIHCKPWYAGS
CDRKSAEAALYKSNRDGSFLIRKSSGHNSKQPYTLVVFYNRRVYNIPVRYIETTKQYALG
SKKNGEEHFNSVADIIKNHQHTPLVLIDSQSNTKDSTRLKYAVKVS
Download sequence
Identical sequences F6U5K0
ENSMODP00000005960 XP_007478774.1.35504 ENSMODP00000005960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]