SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005987 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000005987
Domain Number - Region: 60-138
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000106
Family Canonical RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005987   Gene: ENSMODG00000004862   Transcript: ENSMODT00000006113
Sequence length 524
Comment pep:known_by_projection chromosome:BROADO5:2:256853209:256857231:-1 gene:ENSMODG00000004862 transcript:ENSMODT00000006113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASMKGSVSESESEPESVRAEEEKDEAEEAAKEKEKPKEEEREKPKEKPKETLGLEFKP
RPLHKTCSLFMRNIAPNIPRAEIISLCKKYPGFMRVALSEPQPERRFFRRGWVTFDRSVN
IKEICWNLQNIRLRECELSPGVNRDLTRRVRNVNGITQHKQIVRNDIKLAAKLIHTLDDR
TQLWGAESGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGNSGGGGPPEEPPKEGN
PAEINVERDEKLLKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGPFYHPI
LFTTVVEWQKTFEEKLTPLLSVRESLSEDEAQKMGRKDPEQEVEKFVTSNTQELGKDKWL
CPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEVKPAQPPGPA
QIIHVPVRAVLPPGLTGLPYPHQTPQGLMPYGQPRPPILGYGVPTGGPPYGGPHAPYGAG
RGNYDSFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPEDVDFF
Download sequence
Identical sequences F6TNX5
ENSMODP00000005987 ENSMODP00000005987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]