SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005988 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005988
Domain Number 1 Region: 10-370
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.06e-123
Family Motor proteins 0.000000464
Further Details:      
 
Domain Number 2 Region: 1049-1125
Classification Level Classification E-value
Superfamily SET domain 0.0000621
Family Histone lysine methyltransferases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005988   Gene: ENSMODG00000004864   Transcript: ENSMODT00000006114
Sequence length 1235
Comment pep:novel chromosome:BROADO5:X:70551414:70634189:-1 gene:ENSMODG00000004864 transcript:ENSMODT00000006114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEEVKGIPVKVALRCRPLLPRELEEGCQTCLSFVPGEPQVVVGSGEKCFTYDFVFDPSA
EQEEVFNLAVAPLIKGIFQGYNATVLAYGQTGSGKTFSMGSAYTAAQENEPTVGVIPRVI
QLLFTEMDKKVDFEFLLKVSYLEIYNEEILDLLSPSREKSSQINIREDPKEGIKIIGLTE
KTVSLAMDTVSCLEQGNNCRTVASTAMNSQSSRSHAIFTISVEQKKKSDKNSSLRCKLHL
VDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGGFIPYRDSKLTRLLQ
DSLGGNSHTLMIACVSPADSNLEETVNTLRYADRARKIKNKPIVNIDPQTAELNQLKQQV
QQLQVLLLQAHGGTLPVSINVEPSENLQSLMEKNHSLIEENEKLSRGLSEAAGQTAQMLE
RIILTEQANDKMSVKLEELKQHPACKLDLQKLIESLEDQELKENLEIIHSLQHVITQLSV
SQDAAALCMASAADVPAEPNAAQVETSPNTSRSSDGFTTQHALRQAQMSKELLELNKALA
LKEALAKKITQNDSHLQPIQFQYQDNMKSLELEVVSLQKEKEDLIFLLNSAKKDVNQAKL
SERRRKRLQELEGQIIDLKKKLNEQSKLLKLKESTEHTVSKLNQEIRLMKSQRVQLMRQM
KEDAEKFRQWKQQKDKEVIQLKERDRKRQYELLKLEKDFQKQSNVLRRKTEEAAAANRRL
RDALQKQREAADKRKESQSRGMEGTAARVKNWLGNEIEVMVSTEEAKRHLNDLLEDRKML
AQDLVQLKQKKDAGENPPPKLRRRTYSLADLQCYESDDSVTKQIESLETEMELRSAQIAD
LQQKLLDADSEDRARHRWENIATILEAKCALKYLIGELVASKVQNSKLESHLKQSKDCCS
DLQKMLTEERSQTTEMKNELQEDMMKLEQQHQEKVLYLLSQLQQNQVVETQLEDSVSERE
QQLLDRLKFQDEELEKMREVCEQNHQLLQENEAIKQKLNLLQVVSGKKLHLPNVSTLSPD
SSFEYIPPKPRPSRPAKEKLLLRTMEVEDLKSNTEPSGSEADNDEDDDEWKPKKLVKGSK
KNVQGCSCKGWCGNKQCGCRKQKAGCGADCSCDPGKCRNREQQVDASTSAENTQDSEGSF
KLEDPTEVTPGLNFFNPVCATPNNKILREMYDVGQVLTVTKLKKKTPSSAPLEPGPAAAS
QENKAPGEKKKKRVLNSTTSFFSGCTPISEEDGGL
Download sequence
Identical sequences F6TNW7
XP_001368413.2.35504 XP_007507668.1.35504 XP_007507669.1.35504 ENSMODP00000005988 ENSMODP00000005988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]