SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005995 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005995
Domain Number 1 Region: 1569-1783
Classification Level Classification E-value
Superfamily SET domain 4.32e-72
Family Histone lysine methyltransferases 0.00053
Further Details:      
 
Domain Number 2 Region: 1452-1582
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.44e-26
Family PWWP domain 0.0000241
Further Details:      
 
Domain Number 3 Region: 49-142
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.03e-16
Family PWWP domain 0.017
Further Details:      
 
Domain Number 4 Region: 1403-1470
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000377
Family PHD domain 0.003
Further Details:      
 
Domain Number 5 Region: 1800-1874
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000221
Family PHD domain 0.0065
Further Details:      
 
Domain Number 6 Region: 1266-1316
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000354
Family PHD domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005995   Gene: ENSMODG00000004870   Transcript: ENSMODT00000006122
Sequence length 2414
Comment pep:known_by_projection chromosome:BROADO5:1:382751253:382881884:1 gene:ENSMODG00000004870 transcript:ENSMODT00000006122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKKRTPLSDDPESSTSTLGNMIELPGTSSSSTSQELQFCQPKKKPAPLKYGVGQLVWA
KFNRRPWWPSRICCDPLINTHSKMKVSSQRPYRQYYVEALGDPSEKAWVAGKSIVLFEGR
HQFEELPVLRRRGKQKEKGYRHKVPKKILSKWEASVGLAEQRDVPKDFKVRKRIRTSAKL
DSEEDMPFEDCTNDPESEHERVLNGCLKSLAFDSETSSDEKVKPCTKSRVRKRSTSLKRT
SIKKSSSAFESHKEERREKITETLGLNYISSDVSDKQASTELCRIASSLSAASNTTTNYL
FSSCGKTTTKKEFETSNCDSLLGLSESVLISSSSVEIKKPLRSMVHSAKPSRLCYISAGD
EEKRSDSASLWTTSDEESSDSDLDLIDQSSESDGSALEISGSFEKNESESPMEKNEKVQY
SRYRTKNSRVKARKRSRKTSSHLDHLLDCTKAPEPGSEESQGADSDSKMPIIARNDNLST
KYTMPQSISHENSFVKSGLTNQPLLQSKHNKQPKARSIKCKHKESPTAEQPSVLDEDFSL
KCCSSDSKGSPLDCVVNSGKLDSLKLLSNMHEKPRDPAEIETVVVKHVLSELKELSYRSL
NDDLNDSGSSKINKPLLFPSSSGPTCLPIEPNYKFSTLLMMLKDMHDSKTKEQQLMTTQN
VVSYRSPGLGDCSSSSAAGGSKSLVSGGLTHKTEKNGNCIQDSVCQNPGGSESSLTQESS
GSLTGLLSKKRRLTASSRRRANSITRRNCARSKSSKLQDGFLAQMGKDTIESKDLKSEKK
RKLNQPPNMTIETALGECKEAPTSVNKSLSSGPADSKRKQSLQLMEHLTGEDCAHFSDVH
FDPMIKKPETDKNPEKCPSFENGEVLELDSEMNSESSLSDESNDVNHVAPKKRWQRFNQS
RAKTSKRISRSSREKNSKSAFGGLHPCDFLLEGNEGPEDRPSSPSKVLEEEKKQKCEGHL
DIVVPQLNVCDKPNSDGLPRESGLSNFPPQPELNTQVAHSEKKRLRKPSKWLLEYTEKYD
QIFAPKKKQKKVQEQLPKVSSLKENEVQTTQCQPSTDLQNKPVEESSSTKEDPPVLEREA
PFLEGPIGQSELGGGNAELPELTLSVPITREVSSWSSLDSEEPSLKPRNYESKRQRKPTK
KLLESNDLDPGFMPKKGDLTLLRKCYNTGHLENDISGSCTTLTSLEFGEGTNKVFEKQRK
RKRQRHVAAHCKKVRNEDSSREAQNSEGEPITPGTTASPKDSIEESVEHDHGMPVSKKMQ
AERGGGAALKENVCQNCEKVGELLLCEAQCCGAFHLECIGLTEMPKGKFICKECRTGIHT
CFVCKDGEDVKRCLLPLCFRCSLHMCITCHAANPASLSASKGRLMRCVRCPVAYHANDFC
LAAGSKVLASNSIICPNHFAPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECL
NIDIPEGNWYCNDCKAGKKPHYREVVWVKVGRYRWWPAEICHPRAIPSNIDKMRHDVGEF
PVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAVRFEELKAQKEL
RQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKASDENPCGIDSECINR
MLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGE
LIDEEECRARIRYAQEHDITNFYMLTLDKASTENDRIIDAGPKGNYARFMNHCCQPNCET
QKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNHP
NPTEEKSKKLKRRQQVKRRSQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNL
TKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCG
PNPLEPGEIREYVPPPVPLTSGANTHLAEQPSEIPAQRPLMVDKAPGAMGQRLQLSEKTL
VGTCQRPQLSDKPLVMPDSTPQSPDKSPGVSGPRPQPLEVGQRPADTSLVVTSPRPQLSD
KSSQALSGSKSPPSVRSSVAAGLRSQLLDRPLALAGPKPQSLDKSLSTISSKSQQPDRPV
VTTGPRLQPSDKSPITNGPKPQTSDKPLVPLGQRLPPSEKVLSAVVQNLVSNEKALRPVD
QNTRPKDRATMVLELSPRQKERAASPHEITPQPTEKLPVLEQSPWPVNKALGQMPRAAEK
VHPSEAVLQASGRASAPVEHTWQAGKTLIQARLIPRPPAKGYLFEQAPRAAGRVPVSMEQ
SSGSFGKALASGEPMAGSPQSPGLATKATPLMVQSPRPPVKSPDLGPPAEKRLAMTEHPP
WALGKSPAGPTPWPAGKSLAQTCRSPGSPQTLAQTCRPLGKGLNKGPDPKPEQSAVPALN
QTPSNHEPAESKQK
Download sequence
Identical sequences F6T8D2
ENSMODP00000005995 ENSMODP00000005995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]