SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006050 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006050
Domain Number 1 Region: 1-136,268-405
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-63
Family CAF1-like ribonuclease 0.028
Further Details:      
 
Domain Number 2 Region: 172-257
Classification Level Classification E-value
Superfamily R3H domain 1.71e-33
Family R3H domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 433-494
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000129
Family Canonical RBD 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006050   Gene: ENSMODG00000004915   Transcript: ENSMODT00000006178
Sequence length 499
Comment pep:known_by_projection chromosome:BROADO5:6:109021055:109105674:-1 gene:ENSMODG00000004915 transcript:ENSMODT00000006178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMIRSNFKNNLHKVYQAIEEADFLAIDGEFSGISDGPSVTALTNGFDTPEERYHKLKKA
IHSMDFLLFQFGLCTFKYDSTDSKYIMKSFNFYVFPKPFSRTSPDVKFVCQSSSIDFLAN
QGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYISPNASKCPVIIPEDQK
KFIDKVVEKIEDLIQNEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERY
IVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTIH
QFYCPLPEDLSEFKEVTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKEAPFNPP
KVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANFLGSFLSPPKIHVSARSKLIEPF
FNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQVSWIDD
TSAFVSLSQPEQVQIGKYL
Download sequence
Identical sequences F7BH34
ENSMODP00000006050 ENSMODP00000006050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]