SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006156 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006156
Domain Number 1 Region: 1172-1266
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000301
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006156   Gene: ENSMODG00000005006   Transcript: ENSMODT00000006286
Sequence length 1271
Comment pep:known_by_projection chromosome:BROADO5:8:221768130:221928706:1 gene:ENSMODG00000005006 transcript:ENSMODT00000006286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALGSGGGAGTGAGDDDFDQFDKPGAERSWRRRTGDDDWDSELEDDLLGEDLLSGKKN
QSDLSDEELNDDLLQSDNEDELNFSSQGVTISLNPKSGMVTSFELSDNTNDQSVEHESEY
EQGEDEMIYHKSDGSELYPQDYTEEEQYEGHDAELTEDQIEYVEEQGEEEIDNDEVLDIE
INEPLDEFPDEEYMQSYGGPQGMQEQDYVAEDELEEMADSQAAPESEEGAIETLELQKEI
KEESDEEEEDDEESGRQRFKTERKEGTVIRLSDVPRERRNIPETLELSAEAKAALLEFEE
RERQHKQGRYGSRRGGRRGGSLMCRGMGEQRRDNSERGRIKDHRPGLLPTQPPVVTHSPR
LIPPPQPQPQPQPQPPPPPPPPPPPQQQPIRSLFQQQQLQPLLPLQHPHHPSPPQGMHMP
PQMETPRIMMTPPPVTPQQPKNIHINPHFKGTVVTPVQVPLLPVPSQPRPAVGPQRFPVP
PEFPQHTPGPVPTNFNQPPRLPLQDQWRAPPPPQDRDHFFLGVSGEPRFPSHPLFEQRSP
PPPPPPPTILNSSHPVPTQNPLPFTQPGPAFNQQGQQPVFPRERPVRPNIQPPGPVGILH
FNQPGSTNTRPFIPPRQPFLPGPGQPFLPTHTQPNMQGPLHPPLPPPHQPQPQPQQQQQP
QHQQQQPQHQPQHHQHQPQHQPPLQPQHQPPHQPPHQPPPQHQPPHQPQHQPQHQPQHQP
PHQPQHQPQQHQPQHQHHHHLSVPPPPLMPMSQPPFRPHMQTSQPQQNNSRMQCPQRQGP
RHSAASQNVVKRPIQQMQPTAPRNSNLRELPIAPSHVIEMSNNRCSSTPAAQVKPITSTQ
SSARSVVGVRTSQGKTEMKVKPVSPVVQAKVEVKSEPEFPDEDEETRLYRLKIEEQKRLR
EEILKQKELRRQQQAGARKRELLERLAQQQQQPYTPQPPVQQEEQTSLSPTNGNPLLPYP
GAQVRQNVKNRLLVKKQDITITNVQPKTSNFVQAGANLQYQGQPMKPMKQLRQNRTVPQT
QLQPSHKVLQTKPPDMDELPTPTQTTRVASIQGQPQEMKPGVKRTVMQRANSGSGDGPHV
SSKVRVIKLSGGQGGENVGFFHPEGQPQRLPQSPELRQHPVRKVTLTKGTTLHQQQQSPV
AAHVHSTVPPGVKNVQGSHPAKKVIMHGRGRGVAGQMGRGRLMPNKQNLRVVECKPQPCI
VSVEGLSSSTTDVQLKNLLMSVGPIQSLQMLPQQRKAIAKFKEPAHALAFQQKFHRHMID
LSHINVALIVE
Download sequence
Identical sequences F7F706
ENSMODP00000006156 XP_007504735.1.35504 ENSMODP00000006156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]