SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006200 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006200
Domain Number 1 Region: 175-265,310-392
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.83e-45
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 2 Region: 86-169
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.58e-27
Family Canonical RBD 0.0000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006200   Gene: ENSMODG00000005041   Transcript: ENSMODT00000006330
Sequence length 395
Comment pep:known_by_projection chromosome:BROADO5:3:461667394:461750004:1 gene:ENSMODG00000005041 transcript:ENSMODT00000006330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRSGGGGPGLRWAGAGLCALRRSRRRCRRRRRRRYRGRAEPLLSRPPPPPASGGVPGP
PAGTQIFYKMSNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKL
IRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYIS
GLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHK
PPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMTGL
SGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVT
MTNYEEAAMAIASLNGYRLGDKILQVSFKTNKAHK
Download sequence
Identical sequences F7BEV0
ENSMODP00000006200 ENSMODP00000006200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]