SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006277 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006277
Domain Number 1 Region: 46-83
Classification Level Classification E-value
Superfamily SAP domain 0.0000022
Family SAP domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006277
Domain Number - Region: 951-1001
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0933
Family Canonical RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006277   Gene: ENSMODG00000005083   Transcript: ENSMODT00000006407
Sequence length 1207
Comment pep:known_by_projection chromosome:BROADO5:1:172346707:172385989:-1 gene:ENSMODG00000005083 transcript:ENSMODT00000006407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGRGRFGTFEGRWRKLPKMPEAVETPSTSHKMAELEEVTLDGKPLQALRVTDLKAALEQ
RGLAKSGQKSALVKRLKGALMLENLQKHSTPHTAFQPNSQIGEEMSQNSFIKQYLEKQQE
LLRQRLEREAREAAELEAEALALAKDKMHYTEGVVSILPPVFQDKSLIQFSSCLLFLLAG
KSCSISEEKGESDDERPRKGERRSSRVRQARAAKLSESSLATEEEEERETPSRNLRARAD
RNGGKEESRAAFQEAVEGVTKGIGSQEQEGLEKGGRVTGAQEEGEVCQLARPQQEKGVKL
SEVEVKAEEENKGEKEVKAVKSPERKQKSPSPPRLTEDLLKVSLRPQPEQVAREEETPPP
LLTKEASTPPAPSEPTTGEETEPLEGPAPPDLTQRSPPFEEAEAKELLISPHTVQVVGRL
PSLPSPPGTKARSPIEISQEGTSLISTERSTGTRPPTEKALQSESEHSGPLIALKAEESN
LIKVNTEVPLEQPSSLVQKERKGDSPTPLPSHRTKRSADSSPSSQSSSSSSTSRSRSHSP
DSSGSRSQSPPRSKQRDSSWSRSCSNPRSGTKVGSRSTSESRSRSRSRSRSASSNSRKSR
SPGVSRDSSTSYSHTKDPSPGQEVAPLSSPSVLQQQVLEPKERTTISPAFAPMRGMSQAE
PVEKHKTQRLKPERGSPKKSEAEEAEPPAATERAPEVQTPQQPASGKIQHIVEEKEEVTM
ETTENRPENEVPEPPMPIADAASSEERPEGNAEDEEKKESSMPKSFKRKISVVSATKGVP
AGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAIVDLHADD
SRISEDETERNGEDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEVEPPEAPQV
SVEVALPPPEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKINNIVH
ISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCYIYLSRSIKSIFILSYPQLDFHR
GLLPDRPSEPKAEEQGGPRPLHPPPPPPAQPPHHPRAEQREQERAVREQWAEREREMERR
ERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFR
KTKAAPCIYWLPLTDCQIVKKEAERAERAKEREKRRKELEEQQKEREKEAERERSRQLER
EKRREHS
Download sequence
Identical sequences F6ZED7
ENSMODP00000006277 ENSMODP00000006277 13616.ENSMODP00000006277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]