SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006326 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006326
Domain Number 1 Region: 65-178
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-23
Family SH2 domain 0.00026
Further Details:      
 
Domain Number 2 Region: 164-213
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000824
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006326   Gene: ENSMODG00000005140   Transcript: ENSMODT00000006458
Sequence length 214
Comment pep:known_by_projection chromosome:BROADO5:6:110113796:110114470:1 gene:ENSMODG00000005140 transcript:ENSMODT00000006458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHSKVAADNAVTADTRRRLDPSPSPPSHRAGREHPSPQPRPQHGLAPQHGAGDTHFRT
FRSQADYFSITRASALLDACGFYWGPLSVNVAHEKLKGEPVGTFLVRDSRQKNCFFAISV
KMASGPTSIRVNFQAGRFNLDGSRETFDCLFKLLEHYLNSPRKMLVTPLRQLRVRPLQEL
CRKSIVATFGRDNLGKIPLNPVLKDYLKSFPFQI
Download sequence
Identical sequences F7EQF4
ENSMODP00000006326 13616.ENSMODP00000006326 ENSMODP00000006326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]