SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006367 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006367
Domain Number 1 Region: 41-792
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-279
Family Motor proteins 0.0000000000979
Further Details:      
 
Domain Number 2 Region: 1984-2100
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-22
Family Second domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 1252-1355
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-20
Family First domain of FERM 0.04
Further Details:      
 
Domain Number 4 Region: 2101-2191
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1347-1441
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000249
Family Second domain of FERM 0.0083
Further Details:      
 
Domain Number 6 Region: 1884-1992
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000196
Family First domain of FERM 0.091
Further Details:      
 
Domain Number 7 Region: 1599-1666
Classification Level Classification E-value
Superfamily SH3-domain 0.000000123
Family SH3-domain 0.0048
Further Details:      
 
Domain Number 8 Region: 794-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000558
Family Motor proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006367   Gene: ENSMODG00000005168   Transcript: ENSMODT00000006500
Sequence length 2205
Comment pep:known_by_projection chromosome:BROADO5:4:336447002:336631416:-1 gene:ENSMODG00000005168 transcript:ENSMODT00000006500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVILQQGDYVWMDLKTGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATNIKPMH
PTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHVIYTYTGSILVAVNPYQLLPIYSPEHIR
QYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKS
RVCRQAPDERNYHVFYCMLEGMTADQKRKLGLGQATDYNYLAMGNCTTCDGRDDSKEYAN
IRSAMKVLMFTDTENWEISKLLASILHMGNLKYEARTFENLDACEVLFSTSLATTATLLE
VHPPDLMNCLTSRTIITRGETVSTPLSKEQALDVRDAFVKGIYGRLFVWIVDKINAAIYR
PPTQGVKNTRRSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVWHVFKLEQEEYNLE
NIDWLHIEFTDNQEALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNTNYIP
PKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFVKQIFQADVAMG
AETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEFKRPMLFDRHLCVRQLRYSG
MMETIRIRRAGYPIRYTFVEFVERYRVLMPGVKPAYKQEDLRGTCQRIAEVVLGKHDDWQ
IGKTKIFLKDHHDMLLEIERDKAITDRVILLQKVIRGFKDRSNYLKLKNAATLIQRHWRG
HNCRKNYGAMRIGFLRLQALYRSRKLHKQYRLARRRIIDFQAKCRGYLVRRAFRHRLWAV
LTVQAYARGMIARRLYRRLKAEYLRRLEAEKLRLAEEEKLKKEMSAKKAKEEAEKKHQVR
LAQLAREDAEREVKEKEEARRKKELLDKMERARNEPVNDSDMVDKMFGFLGTTSSLPGQE
GQAPTGFEDLERSKKLMVEDDLDSALPLPDEDEEDLSEYKFAKFAATYFQGTTTHTYTRR
PLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGK
KTYKRELQALQGEGEGGHSDGLKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGN
SMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQICKQLTHNPSKSSYARGWILVSLCVG
CFAPSEKFVKYLRNYMNGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIML
PVTFMDGTTKTLLADSATTARELCNSLADKITLRDRFGFSLYIALFDKVSSLGSGNDHVM
DAISQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHNPRDDSVATNLIYQQVVRGVKFGEY
RCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHK
KGIYAHRRTDPQKKEDVVNFARFKWPLLFSRFYEAFKFSGASLPQNDVIVAVTGQGDTQE
ELVQSVRPARDSLICKRRPLTPFLILNLQCLQFSPDNPQNEGLEVSTPALSCSGGKLQAQ
SFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPVGEESGFLSFL
KGDLIILDHDTGEHVMNSGWANGVNERTKIRGDFPTDCVYVMPTATAPSRETVALITMTP
AQRQDIIRLTQLNMAEPEVRVKPYTLEEFSYDYFRPPPKHTLSRVMISKARGKDKLWSHT
REPLKQALLKKILGNEELISLTDGVPMLKYMGDYPSKRTRSVNELTDQIFEGALKAEPLK
DEIYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSSILLPHVQRFLQSRKHCQLSTDC
MQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEVPRVGGITKAKDFCQS
ISTRLLLKASDGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPMKDGIVPSLTYQ
VFFMKKLWTNTVPGKDPMADSIFHYYQELPKYLRGYHKSTREEVLQLGALIYRVKFEDDK
SYFPSIPKMLRELVPQDLIRQISPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTF
GSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHIT
IGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMSRQRGSRAGR
Download sequence
Identical sequences F7E7U6
ENSMODP00000006367 ENSMODP00000006367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]