SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006371 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006371
Domain Number 1 Region: 245-349
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-26
Family Canonical RBD 0.00000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006371   Gene: ENSMODG00000005173   Transcript: ENSMODT00000006504
Sequence length 351
Comment pep:novel chromosome:BROADO5:3:431345926:431350799:1 gene:ENSMODG00000005173 transcript:ENSMODT00000006504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQPRRRKWISESISVSCLWPGLRLRGRSRTMPTGDFDSKPSWADQVEEEGDDDKCVTSE
LLKGIPLATGEPNNEPELLPGAPLPAPKEVINGNIKTITEYKVEDDGKKFKIVRTFRIET
RKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKL
KGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKIPGELEPVQAAQSK
TGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIY
LAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN
Download sequence
Identical sequences F7E7H8
ENSMODP00000006371 ENSMODP00000006371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]