SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006381 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006381
Domain Number 1 Region: 244-327
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000282
Family Canonical RBD 0.0013
Further Details:      
 
Domain Number 2 Region: 12-107
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000421
Family Canonical RBD 0.00061
Further Details:      
 
Domain Number 3 Region: 119-206
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000624
Family Canonical RBD 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006381
Domain Number - Region: 437-468
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0182
Family Canonical RBD 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006381   Gene: ENSMODG00000005183   Transcript: ENSMODT00000006514
Sequence length 497
Comment pep:known_by_projection chromosome:BROADO5:1:686366693:686369650:-1 gene:ENSMODG00000005183 transcript:ENSMODT00000006514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPSPPSGVCPRSSKAEVVDNETVVRARGLPWQSSDQDIARFFKGLNIAKGGRGPCANAQ
GRRTGEALVRFVDSEQRDLSLERHKHHMGARYIEVYKASGEEFLKIAGGTSHEVAQFLSR
EDQVIIRMRGLPFTATPGDVLAFLGPECPVTGGPEGLLFVHYPDGRPTGDAFALFACEEL
AQGALRKHKGILGKRYIELSGAXXXXVSQVLNRYMSSPLIPTLPAPLIPVLPAPFPLAGA
GVRDCVRLRGLPYTASIDDILGFLGEAAGDIRPHGVHMVLNQQGRPSGDAFIQMKSADRA
LVAAQRCHKKMMKERYVEVFPCSGEEMSLVLMGGSLSRSGLSPPPCKLPCLSPPTYAAFQ
TATAVIPTEATAALYPPSALLPAARAPSAPTPVTYYPPPATQLYMNYTTYYPSPPVSPTT
VGYLTAPSTAVAPAPASVLQQPGALVRMQGLPYTAGVKDILSFFQGYQLAPDDYANLVPV
GDPPRPVLQAPKEWVCL
Download sequence
Identical sequences F7DNJ6
ENSMODP00000006381 ENSMODP00000006381 13616.ENSMODP00000006381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]