SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006413 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000006413
Domain Number - Region: 343-368
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0131
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006413   Gene: ENSMODG00000005206   Transcript: ENSMODT00000006547
Sequence length 832
Comment pep:known_by_projection chromosome:BROADO5:X:13412893:13563571:-1 gene:ENSMODG00000005206 transcript:ENSMODT00000006547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRMKKRSSKEGSNRQQGATEDWSVESDDWTSSESEPEQLGLRNPNHPQWQERGLPSKPH
RQLCRSPCLDQPSFSQSGTLQDPKLEEDNKPPMNKDYQAKMDFALKLGYAGDQIHTVLSK
LGADALINDILAELVRLGNKSEEEGQKSGGAEHSHGARDVASPELSLEDEITDTTENLRP
VVIDGSNVAMSHGNKEGFSCRGIQLAVDWFLEKGHKDITVFVPAWRKEQSRPDAPITDQE
ILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFDSDGIIVSNDNYRDLQNEKPEWK
KFIEERLLMFSFVNDKFMPPDDPLGRHGPSLENFLRKKPVIPEHKKQPCPYGKKCTYGHK
CKYYHPERANQPQRSVADELRISAKLSAIKTMSEGALAKGTTAAPAPASKSEPNSGGKQA
APKRQSDPSIRSVAVETEERLPIIRKPETNSAPSLVTALSVPTLPPSKSHAAGALNTRSA
SSPVPGSSQFAHQKSSLEHTASMQYPPILVTNSHGTSVGYAEQYPKYESLGDHGYYSLMS
DFSNISINSTRGADYYGAEPDRHGRGMYSRNPSPCQDKHMSHTSSDPYSSYSDLYLGVVD
TGQEEALKVNRSCSQNHLQPFSHGYHEALTRVQSYGPDEAKQAPHKHPVPRLVLHGQHPV
MGTRSSCPRDYPVPQSIHPPGTAPPGRALVMTRMDSVSDSRLYDGNPMRQRRPPLCREQH
ASWDPLPYPAAADSFGYHSYPLSASLMQPCYEPVMVRSMPEKMEQIWRSPWIGVCSQPRE
HHVIPEHQYQTYKNLCNIFPVGIVLSVMEKNPHMTDAQQLAAMIVAKLRSGR
Download sequence
Identical sequences F7A243
ENSMODP00000006413 ENSMODP00000006413 XP_016282108.1.35504 XP_016282109.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]