SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006415 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006415
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-18
Family Canonical RBD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006415   Gene: ENSMODG00000005207   Transcript: ENSMODT00000006549
Sequence length 71
Comment pep:known_by_projection chromosome:BROADO5:1:244626049:244631449:-1 gene:ENSMODG00000005207 transcript:ENSMODT00000006549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVFVNRIPWTAAANEIKQHFSQFGTIRKCFLPFEKETGFHKGFCWIGFSSEEELQRTLQQ
ENHFIDGVKVR
Download sequence
Identical sequences F7A225
13616.ENSMODP00000006415 ENSMODP00000006415 ENSMODP00000006415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]