SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006466 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006466
Domain Number 1 Region: 34-145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000534
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 2 Region: 144-197
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006466   Gene: ENSMODG00000005246   Transcript: ENSMODT00000006601
Sequence length 243
Comment pep:known_by_projection chromosome:BROADO5:3:375599531:375844850:-1 gene:ENSMODG00000005246 transcript:ENSMODT00000006601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRLFSFALIILNCMDYGHCQANRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH
RGRCFHECPDGFAPLDETMECVEGCEVGPWSEWGTCSRNNRTCGFKWGLETRTRQIVKKP
AKDTIPCPTIAESRRCKMSMRHCPGGKRTPKMKDKRNKKKKKKLIERAQEQHSVFLATDR
ANQ
Download sequence
Identical sequences F6YMW4
ENSMODP00000006466 ENSMODP00000006466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]