SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006475 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006475
Domain Number 1 Region: 62-206
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.12e-36
Family Canonical RBD 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006475   Gene: ENSMODG00000005250   Transcript: ENSMODT00000006610
Sequence length 403
Comment pep:known_by_projection chromosome:BROADO5:4:165863247:166138233:-1 gene:ENSMODG00000005250 transcript:ENSMODT00000006610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKVWKQQMYPQYTTYYYPQYLQAKQSIVPAHPMAPPSPSTTSSNNNSSNSSSSGWDQLS
KTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAV
SALKATGVQAQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTS
RGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPAEPLLCKFADGGQKKRQNQNKYIQN
GRAWHREGEAGMTLTYDPTTAALQNGFYPSPYSIATNRMITQTSITPYIASPVSTYQVQS
PSWMQPQPYILQHPGAVLTPSMDHTMSLQPTSMISPLAQQMSHLSLGNTGTYMPATTAMQ
GAYIPQYTHVQTAAVPVEEASGQQQVAVETSSDHSPYTYQQNK
Download sequence
Identical sequences F7GH32
ENSMODP00000006475 ENSMODP00000006475 XP_007494313.1.35504 XP_020860517.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]