SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006523 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006523
Domain Number 1 Region: 59-156
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-31
Family Canonical RBD 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006523   Gene: ENSMODG00000005290   Transcript: ENSMODT00000006658
Sequence length 230
Comment pep:known_by_projection chromosome:BROADO5:3:456983566:457020941:-1 gene:ENSMODG00000005290 transcript:ENSMODT00000006658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRSVSPGSPCCCPRLPAVSWITQARSSKRTSMFFSLNNTYLRIKTKNWFQDRRMVKMA
SDEGKLFVGGLSFDTNEQSLEQVFSKYGQIAEVVVVKDRETQRSRGFGFVTFENIDDAKD
AMMAMNGKSVDGRQIRVDQAGKSSENRSRGYRGGSSSGRGFFRGGRGRGRGFSRGGGDRG
YGGSRFESRSGGYGSSRDYYSSSRSQGGYGDRSSGGSYRDSYDSYATHNE
Download sequence
Identical sequences F7E6M5
ENSMODP00000006523 ENSMODP00000006523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]