SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006552 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006552
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.42e-18
Family THAP domain 0.0006
Further Details:      
 
Domain Number 2 Region: 250-530,582-730
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000174
Family Hermes transposase-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006552   Gene: ENSMODG00000005315   Transcript: ENSMODT00000006688
Sequence length 767
Comment pep:known_by_projection chromosome:BROADO5:4:338126266:338149484:1 gene:ENSMODG00000005315 transcript:ENSMODT00000006688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNFCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAK
HFETSMICKSSPYRTVLRDNAVPTIFDLTSHLNNPHSRHRKRIKELSEDEIKSLKERKID
ESSEQEQTNQETNNSNSAQNAVAEGGGEQDEEVLPLTLEEKENKDYLKSLFEILILMGKQ
NIPLDGHETDEIPEGIFMPDNFQALLECRINAGDEVLRKRFETTAVNMLFCSKTQQKQML
EICESCIREEMLREIRDSHFFSIVTDDVVDIAGEEHLPVLVRFVDDSHNLREEFIGFLPY
EADAEILAIKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVAMRLLEKYPQAVYTLC
SSCALNTWLAKSIPVVGVSVALGIIEEVCSFFHRSPQLLVELDNVISVLFQNSEEKGNEL
KEICRSQWTGRHDAFEILVDLLQALVLCLDNINSDTTVRWDNFIAGQAFVLGSALVDFDF
IVTVVVLKNILSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEVYHEFWFEEA
TNLATKLDIEIKLPGKFRRSQQANLEPEVTSESYYKEVLSVPTVEHIIQELKDIFSEQHL
KALKCLSLVPSVMGQLKFNTSEEHHADMYKSDLPNPDTLSAELHCWRIKWKHRGKDIELP
ATIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRDTLTAHRSSN
LALLNINFDIKHDLDLMVDTYIKLYASKLDLQEEVLPTSNSEPTENT
Download sequence
Identical sequences F7DLK8
XP_001378373.1.35504 13616.ENSMODP00000006552 ENSMODP00000006552 ENSMODP00000006552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]