SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006815 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006815
Domain Number 1 Region: 203-305
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-22
Family Canonical RBD 0.00000332
Further Details:      
 
Domain Number 2 Region: 385-469,499-568
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.19e-19
Family Canonical RBD 0.0000522
Further Details:      
 
Domain Number 3 Region: 79-163
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.03e-18
Family Canonical RBD 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006815   Gene: ENSMODG00000005502   Transcript: ENSMODT00000006953
Sequence length 579
Comment pep:known_by_projection chromosome:BROADO5:6:53439852:53538621:1 gene:ENSMODG00000005502 transcript:ENSMODT00000006953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVEFYNRNCVSFRESYMDMVTLQSWEPQKWGIFFGQERFGRGSDELLSSGITNGPFTMS
SSTPTTANGNDSKKFKGDRSPCSPSRVLHLRKIPNDVTETEVISLGLPFGKVTNLLMLKG
KSQAFLEMASEEAAVTMVNYYTPVTPHLRSQPVFIQYSNHRELKTDNLPNQARAQAALQA
VNAVQSGSLALTAAPGSEGGVLPGQSPVLRIIVENLFYPVTLEVLYQIFSKFGTVLRIIT
FTKNNQFQALLQYADPLNAHYAKMTLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDF
TRLDLPSGDGQPSLDPTMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALG
PLTITTSAVTGRMAIPGVPGVPGNSVLLVSNLNPDAITPHGLFILFGVYGDVQRVKIMFN
KKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQLVQLPREGQEDQGLTKDFSN
SPLHRFKKPGSKNFQNIYPPSATLHLSNIPPSVMVDDLKNLFTEAGCTVKAFKFFQKDRK
MALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI
Download sequence
Identical sequences F7GFP3
ENSMODP00000006815 ENSMODP00000006815 XP_007498218.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]