SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006859 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006859
Domain Number 1 Region: 49-166
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-25
Family SH2 domain 0.00065
Further Details:      
 
Domain Number 2 Region: 421-577
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-24
Family Ras GEF 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006859   Gene: ENSMODG00000005542   Transcript: ENSMODT00000006997
Sequence length 713
Comment pep:known_by_projection chromosome:BROADO5:1:453362842:453391159:-1 gene:ENSMODG00000005542 transcript:ENSMODT00000006997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVGRRYHTLGPRGVHSGLESGGDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRS
HAWYHGRIPREVSESLVQRNGDFLIRDSLTSLGDYVLTCRWHNQPLHFKINKVMVKASEN
YTHIQYLFEQESFDHVPALVRYYVGSRKAVSEQSGAIIYCPINRTFPLRYLEASYGLGHG
KSGGPASPSSQKGGHMKRRSVTMTDGLTADKITRGEGCPTSVSLPHHRDAIRNCALSMDQ
IPDLHSPMSPISESPGSPAYSTVTRVNVPGIPSAGMTPTSPVIRRSSEPQLCPGNGTKPP
PSEPGNSVHPTPCHSYRQASPSPSLNSYSDPDSGHYCQLQPPIRGSRERVAPEPPTRLGG
VKSYVERLKVEEGQHLMGGRAPENGPREGDQGGGFIPPVIEVTSSFNPTTFQSLLIPKDN
KPLEMSTLKKVKELLADVDAKTLARHVTKVDCLVARILGVTKEMQGLMGVRSGMELLTLP
HGRQLRLDLLERFHTMSIMLAVDILGCTGSTEERAALLHKTIQLAAELRGTMGNMFSFAA
VMSALDMAQISRLEQTWMTLRQRHTEGAILYEKKLKPFLKSLNEGKDSPPLSNTTFPHVL
PLITLLECDTAPAEGPEPWESTEHGVEVVLAHLEAARTVAHHGGLYHTNAEVKLQGFQAL
PELLEVFSTEFQMRLLWGSQGAASSQALRYEKFDKVLTALSHKLEPAVRSSEL
Download sequence
Identical sequences F7FHR7
ENSMODP00000006859 XP_007475109.1.35504 ENSMODP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]