SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006917 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006917
Domain Number 1 Region: 188-355
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.76e-30
Family Canonical RBD 0.0044
Further Details:      
 
Domain Number 2 Region: 112-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000242
Family Canonical RBD 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006917   Gene: ENSMODG00000005584   Transcript: ENSMODT00000007057
Sequence length 770
Comment pep:known_by_projection chromosome:BROADO5:3:431031143:431041756:1 gene:ENSMODG00000005584 transcript:ENSMODT00000007057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRDAGGRSIATNRLRKEQREVGLALANGQARRRCRSRPLRPGSLIPEGAGFPKMAADV
SVTHRPPLSPKPEAEAEAGGVGERRTLDEKLPPLDPEEVRSRLERTERQFRNRRKILIRG
LPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAESAIRTFHQSHLRDKELSV
QLQPTDALLCIANLPPSYTQQQFEELVRPFGNLERCFLVYSERSGHSKGYGFVEYMKKDS
AARAKSDLLGKPLGPRTLYVHWTDASQLTPALLHSRCLCVDHLPQGYSDVDELRQALSSV
HPPTFCQLAYGQDGQLKGFAVLEYETSQMAEEAQQQADGLVLAGNSVRVSFCAPGPPGRS
MLAALIAAQATALNRGKGLLPEPNILQILSSLGPPASLQLLLNPLLHGPGGGNKQGLLGA
PPAMPLLNSPALSTALLQLALQTQGQVQQKPGILGDSPLGSFQSGTQPSNTLLGELPAGG
VLPSDIPPVRGKPPSLLPPLLGTAGGDREALALGASATQLTPPPASLRGSVLSGLQKLSE
NGPPPTSGVSLLGEPPKDFRIPLNPYLNLHSLLPTGSGSKAFNLKSSMLGGTSSTRLSTD
SGLSSDGYGFDYPPDLGPRRMFSHPRESVGPILGPLGHSRHKMSPPPSGFGERGSGSGGL
PHFYSGSPTSYFTSGLQAGLKQSHLSKVVGTSPMGSGEGLLGLGPGPDSHGSLMKTPMGG
QKRGFSHLLPSPEPSPEGGCLKALSLSPRPVQRTQHLWFILKLLGLHFSP
Download sequence
Identical sequences F7E4I0
ENSMODP00000006917 ENSMODP00000006917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]