SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007024 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007024
Domain Number 1 Region: 33-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-24
Family La domain 0.00077
Further Details:      
 
Domain Number 2 Region: 118-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-20
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 3 Region: 457-561
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000245
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007024   Gene: ENSMODG00000005669   Transcript: ENSMODT00000007165
Sequence length 590
Comment pep:known_by_projection chromosome:BROADO5:5:66058717:66090061:1 gene:ENSMODG00000005669 transcript:ENSMODT00000007165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METENGNQDKSMEEESTEQKKEGEKKKRSRVKQVLSDIAKQVDFWFGDANLHKDRFLREQ
IEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSSSVVELDLEGTRVRRRQPLGEKPK
DVDDRTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAD
KAIEFLNNPPEEAPRKPGMFPKTVKNKPIPTLNTNICRVSEEKKKKKKKKSRIKKEGVQT
AVEPKETNTDATDEHLEHVNKLKRHRTSEGSEVSSSDTQRPPCKKEKKKKERSEVLSLPE
EARGKRKRMNSGDVETLMPRSKVKKSSLKEESTKEEQSKAEIPKDCKDLEVSTEEEKDAG
DMKDGSLLKSKRKHKKKHKERHKMGEEVIPLRVLSKSEWMELKKEYLALQKASMASLKKT
ISQIKSENSRQMDTDPGIKNGHANSEDCQPPEKVNTMGPQFVSGVIVKIISTDPLPSRKH
LRETLAVIAEVVYVDVLEGDTECHARFKTPEDAQAVIKAHAEIKKKYNWKFEILSGDHEQ
RYWQKILVDRQAKLNQPREKKRGTEKLINKAEKIRLAKTQQASQHIRFSE
Download sequence
Identical sequences F6VKQ2
ENSMODP00000007024 ENSMODP00000007024 XP_007496077.1.35504 XP_007496078.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]