SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007028 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007028
Domain Number 1 Region: 22-113
Classification Level Classification E-value
Superfamily Immunoglobulin 6.23e-27
Family V set domains (antibody variable domain-like) 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007028   Gene: ENSMODG00000005673   Transcript: ENSMODT00000007169
Sequence length 124
Comment pep:novel chromosome:BROADO5:1:171195063:171195635:1 gene:ENSMODG00000005673 transcript:ENSMODT00000007169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHVLGDLLFILYLQFNCNGQQEVKQSPQTLKVQEGGNATMNCTYSSTAFTNLQWFRQDP
GKGLILLFYIASEGKQKGRLRATMNRKDLLSSLHIIDTQLEDSGTYLCAGSHSDPQAPAG
CAQT
Download sequence
Identical sequences F6VKM7
ENSMODP00000007028 ENSMODP00000007028 13616.ENSMODP00000007028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]