SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007256 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007256
Domain Number 1 Region: 61-167
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-28
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 170-314
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-27
Family Third domain of FERM 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007256
Domain Number - Region: 12-61
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00909
Family First domain of FERM 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007256   Gene: ENSMODG00000005865   Transcript: ENSMODT00000007404
Sequence length 530
Comment pep:known_by_projection chromosome:BROADO5:2:452719392:452745205:-1 gene:ENSMODG00000005865 transcript:ENSMODT00000007404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISTALTTVFVNFADNEYIFMDLEQKLSKYFLKDWKKEIYKGNEKSNPPFVAFFRVQYYV
ENGRIISDKVARRLYYHHLKEQVLRSQCTHKEEVYFLLAAYGLQADLGNYRETAHVGKYF
EPHSYFPQWIITKRGRDYILKHAPEIHREQQGLTTKEAVLKFIKESCLLEDVPVHFFKLQ
KDKKEDRPTIVLGLTLKGMHIYQEVNHSRQLLYDFPWAHVGKLAFLGKKFEIQPDGLPSA
RKLVYYTGCPFRSRHLLQLLSNSHRLYLNVQPVLKQIRQLEEVEEKKRYRESYISDTLEM
DLDQSDKHSHGSGSSRGSGRNHHRLSHRSTDSHGSSHTSGIEADSRHRVSVEMSVDEPFG
VELGHEVEVMVDGPEDVTVDDPVGNNRLEKAMEEVSMNPLTLGLHGYEDSHQEPFAVVQI
TLVKMRGQSVEALNQLREIKARECSDQHSQSLDDIRLYQQQHPPPSTNLSSPTSHSYTFG
CALEDKLATYGCVYSTADCMTKSALYGKRSMNCLSLDLLGEDQVPEEFVV
Download sequence
Identical sequences F6T4R5
XP_016284504.1.35504 ENSMODP00000007256 ENSMODP00000007256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]