SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007341 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007341
Domain Number 1 Region: 221-269,344-379
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000711
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007341   Gene: ENSMODG00000005934   Transcript: ENSMODT00000007490
Sequence length 804
Comment pep:known_by_projection chromosome:BROADO5:2:137653874:137699284:-1 gene:ENSMODG00000005934 transcript:ENSMODT00000007490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGTTNLSTLALWHSGVIRSRERLGVGDKPIDSYCYSTANSSTVLQGVTFGGVPTVLLID
VSCFLFLIVVFSIIRRRFWDYGRIALVSEKDSESRYQRLSSSSSGHHDYESDLGCCSWLT
AVFRMQDEQIQEWCGDDAIHYLSFQRHIIFLLVVISFLSLCIILPVNLSGDLLDKDPYSF
GRTTIANLQVGNNLLWLHTIFAVIYLLLTIGFMRHHTQSIKYKKENLVRRTLFITGLPKN
TRKEVLESHFRDAYPTCTVVEVQLCYDVAKLIYLCNERKKAEKSLNYYTNLQTKTGERTL
INPKPCGQFCFCEIQGCEKEDAITYYARMKDRLLQRLSQEEHTVQDHPLGMAFVTFQESS
MANFILKDFNACKCQGCRCKGDPQPSSYSKELGPSNWTVAFATYPEDICWKNLSIQGLRW
WFQWSGINFILSVVLFFLTTPSIILSTMDKFNVTKPIHALNDPIISQFFPTLLLWSFSAL
LPSIVYYSTLLESHWTKSGENRIMMIKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKASS
ETSIRLECVFLPDQGAFFVNYVIASAFIGNGMELLRLPGLILYTIRMIMAKTAADRRNLK
QQQAFEYEFGAMYAWMLCVFTVIMAYSITCPIIVPFGLIYILLKHMVDRHNLYFAYLPTK
LEKKIHFAAVNQALAAPILCLFWLYFFSFLRLGFQAPTSLFTLLAVLLTIAVCIGYTCFG
CFKHLSPLNYKTDESANDKGSETDGRLPPRAAMYVPRVLSSLASERTSLSPQDQQTYGAI
QNISGTVPGQHSPKPSGFAPSLDA
Download sequence
Identical sequences F6WW80
XP_007481556.1.35504 XP_007481557.1.35504 ENSMODP00000007341 ENSMODP00000007341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]