SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007362 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007362
Domain Number 1 Region: 134-216
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.09e-21
Family La domain 0.0000584
Further Details:      
 
Domain Number 2 Region: 211-289
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000318
Family Canonical RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007362   Gene: ENSMODG00000005957   Transcript: ENSMODT00000007511
Sequence length 732
Comment pep:known_by_projection chromosome:BROADO5:8:228511620:228610405:-1 gene:ENSMODG00000005957 transcript:ENSMODT00000007511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSDQDTKVVAEPQVQQVQEVKDSSHLEPAKVSELNPNAKVWGNHLLHLEASGTTDGNVS
KTWEEIADHPPDACKEGLDANSNVDTSYPNAVLGDLQEPVSLSDQTDMSTLVLDHSEYEP
MPENSQTEESEEIPEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDH
IKKLSTDLDLIVEVLRSLPLVQVDENGEKVRPNQNRCIVILREVPESTPVEEVEALFTGD
NLPKFVNCEFAYNDNWFITFESEADAQQAYKYLREELKIFQGKPIKARIKAKAIAINTFL
PKNGYRPLDMNLYTQQRYTTSFYLPPVYNPHQQFPLYSLITPQTWSATQSYLDPSLVTPF
PNTGFINGFTSPTFKPAASPLTSLRQYPPRNRNPSKSHLRHTLPTTDRGPGLLESPTIFN
FSTDRLINGVRSPQTRQPGQNRTRMQTTSTYAKRDIGIGRMEQNNLETSSLLGRGRKNSY
GLRKKREDKFTRSQTQSPTPPKPPSPSFELGLSSFPPLPGAAGNLKTEDLFENRFSNMVI
GTSKERPLNVDASTNIIPAIMPREPSMSGSSVLSAGYEQSPSPVQLPEESKVVENKQRET
HSVERLPCTLVPTACRSVQVNGVPTESRKPSYAEICQRTTKELPPPPPPLPPPPPPPPLQ
TQKEQKSNSAGCGKEEKKPTEPPVERCREPPPSKSNPGHPKDQRRQSGRRSPPPAPGKRL
NKEQSTPPRSPQ
Download sequence
Identical sequences F6WFA3
ENSMODP00000007362 ENSMODP00000007362 XP_007504763.1.35504 XP_007504764.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]