SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007546 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007546
Domain Number 1 Region: 384-607
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-52
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 611-743
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-26
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 150-238
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000258
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007546   Gene: ENSMODG00000006084   Transcript: ENSMODT00000007697
Sequence length 1067
Comment pep:novel chromosome:BROADO5:4:394692685:394805107:-1 gene:ENSMODG00000006084 transcript:ENSMODT00000007697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVLTKYGSPPRSWLNLRLGTNDRSLTEEKGLRCQNPECIDKRRASKVCHHADCQQLHR
RGPLNLCEVCDGKFHSTMHFDGHIRFDLPPQGSVLSRNVSTRSCPPRTSPASDLEEDDEG
LMDSKGEKKGSSLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVL
LPVFERKGIELSKVDIYLDQSNTPLSLPFEAYRFGGHYLRVKAKPGDEVKVELAVKDFKS
LSLPIPGPPASDRADQQARRESLDILAPGRRRKNMTEFLGDASIPGLEPSMPSSSSLPSN
GIDTWKNRAASRFSGLFSSGPSVSSFGREVDKMEQLESKLHSYSLFGLPKLPQQLRFDHD
SWEEEEEEEDADLVLEDSWQELIDGTEDLTRRQCHQQEAVWELLHTEASYIKKLRVITDL
FMCCLLNLQESGLLCEVDIERLFSNTQEIIQLHKGLWSSVMAPILDKARRTRTLLQPADL
LKGFKMFGSLFKPYIRYCMEEEGCMEYMRSLLRDSDLFRVYVTWAEKHQQCQRLKLSDML
AKPHQRLTKYPLLLKSVLKKTDDPPTKEAIVTMISSVERFISHINSRMRQRQEQQRLVAI
ISRIDSYEVVESSTDEVDKLLKEFLRFDLTAPIPGTSPDDTRQLLLEGSLKMKEGKDSKM
DVYCFLFTDLFLVTKPVKKAERTKVIRQPLMVDKIVCRELRDPGSFLLIYLNEFRSAVGA
FTFQASGQALCRGWVEAIFNAQNLLQRMRLQEHQGSHQQHLQSLEEEEDEEEEEEEGESS
TSGASSPTILRKSNNSLNSQCCPSDGSTETLAVVVVEPGESPSSPDFEGGPFSSRSDETS
ISTTASSTTPTSEADGLLHSAPAECRSCSIDSAYGTLSPTSLKDFVAPAELAPVPAPRPP
DPPDPPAPALPLSPRLRRRTPVQLLPWPRLLKSKSEASLLQLLSGASGRVPPSAPSRSLS
ELCLTTPLLPNGFPRTQMGPCQPPPEARASWDCGGASPSGASGPPEAEDSGCSPGRGDES
PLSRECKKPVSKTTFRAQPSGQHRKLTLAQLYRIRTTLLLNSTLTAS
Download sequence
Identical sequences F7FEF4
ENSMODP00000007546 ENSMODP00000007546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]