SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007549 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007549
Domain Number 1 Region: 258-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-85
Family Protein kinases, catalytic subunit 0.000000000251
Further Details:      
 
Domain Number 2 Region: 147-287
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 87-172
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007549   Gene: ENSMODG00000006090   Transcript: ENSMODT00000007700
Sequence length 1102
Comment pep:known_by_projection chromosome:BROADO5:2:72930036:73076520:-1 gene:ENSMODG00000006090 transcript:ENSMODT00000007700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQVGRVGEAPGLQQPQPRGSRGSSAARPAGRRRDPAGRTEEAGFNIFTQHEALHRPYG
CDVESQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQ
NGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESE
SSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHY
PAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKE
DTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEV
SAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTA
HAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKG
YRMEQPEGCPPKVYELMRACWKWSPSDRPSFAETHQAFETMFHDSSISEEVAEELGRTAS
SSSIVPYLPRLPLLPSKTRTLKKQAENKENIDGTQDSAEPSASSSAPGFIRSTQPPSGSP
ALPRKQRDKSPSSLLEDAKETTFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHK
KYELTGLPEQDRMSMTLPRNCQRSKIQLERTVSTSSQPEESTGRSSDLIPKKLEEGPALS
RERPKAKLLPRGTTALPLRAPLGDAAVIEKDSVGSGASVVPKSKEKNGAVRLGMAGLPED
GERPGWSSPAKAATVLPTTHNHKVPVLISPTLKHAPADVQLIGTDSQGNKFKLLSEHQIP
SSGDKDRPRRVKPKCAPPPPPVMRLLQHPPTCPDLTEEQNTLVGGQLGPEVHEGGKKAAT
VTTPVSAKAGRPAMPPPQVPLTTGSTSPAKMANGTAGTKVALRKTKQAAEKISADKISKE
ALLECADLLSSAITEPMPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSL
QELQVSSAAANLPGTNPVLNNLLSCVQEISDVVQRYNIDLSTAACLTLYNRSSLKDPWIL
LRGLDIHTFGASNRDPWLGKPP
Download sequence
Identical sequences F7FED8
ENSMODP00000007549 ENSMODP00000007549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]