SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007683 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007683
Domain Number 1 Region: 95-217
Classification Level Classification E-value
Superfamily PX domain 5.1e-30
Family PX domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007683
Domain Number - Region: 231-296
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0981
Family Moesin tail domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007683   Gene: ENSMODG00000006200   Transcript: ENSMODT00000007838
Sequence length 347
Comment pep:known_by_projection chromosome:BROADO5:3:151431113:151460696:1 gene:ENSMODG00000006200 transcript:ENSMODT00000007838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPYVPVPIPVGNSSSNFTTNRSQRSSSFGSISTSSNSSKGQPEDSNVGSYKKTSMPDQ
MDNNSSMCSSPLIRTKFTGIESSIEYSTRPVENEDQSTESVNWEERPSTPTILGYEVMEE
RAKFTVYKVLIRRSPEESWVVFRRYTDFSRLNDKLKDMFPGFRLALPPKRWFKDNYNADF
LEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRL
QKELLEKQKEVESLKKLLNEKQLHIDTIENRIRLLSLEHEETLRISREGECIRKIESSAI
EADQDSLDEKNRSDKVPKSGWTDCESEKSITEVEVAEVAYAAEEEEE
Download sequence
Identical sequences F6ZTN3
XP_001377152.1.35504 XP_007486960.1.35504 XP_007486961.1.35504 ENSMODP00000007683 ENSMODP00000007683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]