SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007717 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007717
Domain Number 1 Region: 190-374
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-52
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 499-631
Classification Level Classification E-value
Superfamily PABC (PABP) domain 1.06e-52
Family PABC (PABP) domain 0.00000019
Further Details:      
 
Domain Number 3 Region: 10-179
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.74e-45
Family Canonical RBD 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007717   Gene: ENSMODG00000006222   Transcript: ENSMODT00000007872
Sequence length 634
Comment pep:known chromosome:BROADO5:3:366000213:366015342:-1 gene:ENSMODG00000006222 transcript:ENSMODT00000007872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVMVCDENGSKGYGFVHETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPPSGYFMAAIPQTQNRAAY
YPASQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRV
ANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQ
EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPES
LRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
Download sequence
Identical sequences F7FS75
ENSMODP00000007717 13616.ENSMODP00000007717 ENSMODP00000007717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]