SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007792 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007792
Domain Number 1 Region: 219-288
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000259
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Domain Number 2 Region: 21-44
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007792
Domain Number - Region: 156-180
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000275
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number - Region: 314-341
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000824
Family CCCH zinc finger 0.0037
Further Details:      
 
Domain Number - Region: 2-18
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0445
Family CCCH zinc finger 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007792   Gene: ENSMODG00000006280   Transcript: ENSMODT00000007949
Sequence length 408
Comment pep:known_by_projection chromosome:BROADO5:6:246126690:246142386:1 gene:ENSMODG00000006280 transcript:ENSMODT00000007949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGVCREGSQCLFSHDLSTSKPSTVCKFYQKGYCAYGSRCRYDHMRPAAATSGSAHSAGP
PSLPSPVFHSPHPPPDLTASIMKSSLHEPGKREKRTLVLRDRNLCGLTEEKAKPCAVNDP
GGCSDSNDSLEMKPHSYLEAIRSGLDDLEAGSSDSNEQQLCPYAAAGECHFGDACVYLHG
DVCEICRLQVLHPFDSEQRKTHEKLCMASFEHDMEKAFAFQASQEKVCSICMEVVYEKPS
ASERRFGILSSCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNK
KNELIEAFKQGMGKKACKYFEQGKGTCPFGGKCLYLHAYPDGTRAEPEKPRKQLSSEGTV
RFFNSVRLWDFIEDRESRHIPATEEDDVTELGDLFMHLSGVEESASNP
Download sequence
Identical sequences F7F0I3
ENSMODP00000007792 XP_007500310.1.35504 XP_007500311.1.35504 ENSMODP00000007792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]