SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007804 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007804
Domain Number 1 Region: 8-166
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.5e-43
Family Canonical RBD 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007804   Gene: ENSMODG00000006291   Transcript: ENSMODT00000007961
Sequence length 319
Comment pep:novel chromosome:BROADO5:7:153625496:153637612:1 gene:ENSMODG00000006291 transcript:ENSMODT00000007961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVRAPKEPEQLRKLFIGGLSFQMTDESLRSHFEQWGTLTDCVAMRDPNTKWSGFDFVTYA
TVEEVDAAMNTRLHKVYGRVIEPKRAVSREDSQRPSTHLTVKKIFVGGIKEDTEEHHLRD
YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVIHTVNGHNCEVRK
ALSKQEMASASSSQRGRSGFGNFGGGHGGGFGGNDIFGHGGNFRGRGSFGGSHGGGRYGG
SGDGYNGFVNDGGYGGAGSGSDGQGFGNQSSNFGPMKEGNFGGLSSGPYSGGQYFAKPCN
QGGYGSSSSSSSYCSGRRI
Download sequence
Identical sequences F7CAG1
ENSMODP00000007804 ENSMODP00000007804 13616.ENSMODP00000007804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]