SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007822 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007822
Domain Number 1 Region: 179-282
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-24
Family Canonical RBD 0.00000141
Further Details:      
 
Domain Number 2 Region: 358-448
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.17e-19
Family Canonical RBD 0.0000163
Further Details:      
 
Domain Number 3 Region: 47-144
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.89e-19
Family Canonical RBD 0.00000692
Further Details:      
 
Domain Number 4 Region: 471-555
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000658
Family Canonical RBD 0.00000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007822   Gene: ENSMODG00000006302   Transcript: ENSMODT00000007979
Sequence length 557
Comment pep:known_by_projection chromosome:BROADO5:3:459178042:459208148:-1 gene:ENSMODG00000006302 transcript:ENSMODT00000007979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGIVPDITVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDNRSPGVPSRV
IHVRKLPGDVTEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEASNTMVSYYTTVTPV
LRSQPIYIQFSNHKELKTDNSPNQARAQAALQAVNSVQSGNLALSASAAAADAGMAVAGQ
SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYSDPVSAQHAKLS
LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGAP
GIISASPYAGAGFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLTGA
GNSVLLVSNLNPERVTPQCLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHL
NGQKLHGKPIRITLSKHQTVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSA
TLHLSNIPPSISEEDLKMLFSSNGGMVKGFKFFQKDRKMALIQMGSVEEAIQSLIDLHNH
DLGENHHLRVSFSKSTI
Download sequence
Identical sequences F7BRN9
ENSMODP00000007822 XP_001375584.2.35504 ENSMODP00000007822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]