SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007837 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007837
Domain Number 1 Region: 190-244
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000536
Family UBA domain 0.00031
Further Details:      
 
Domain Number 2 Region: 556-596
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000113
Family Tudor domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007837   Gene: ENSMODG00000006316   Transcript: ENSMODT00000007994
Sequence length 598
Comment pep:known_by_projection chromosome:BROADO5:7:154197035:154360454:-1 gene:ENSMODG00000006316 transcript:ENSMODT00000007994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLQMTDGHISCTAVEFNYMSKISLNTPPGTKVKLSGIIDIKNGFLLLNDTNTVVLGGE
VEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHIQVDSRELDRRKTLQVTAP
AKPPGDNDEFEKQRTAAIAEVSKSKETKTFGGGGGNARSNLNMGTGGNRNREVFQKEKIT
KPEGKYEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLNSNKQKPVL
GPPLRGKGKGRGRGRCEDEEELGNSRPSAPSTLFDFLESKMGSLNMEESKSQSQPLHQGQ
HRLLNNEQNGVKDYNQPRHLPRNDTRQPRNEKPPRFQRDAQNSRQILENSGLSRNRGPER
QSSSVVHEAWTEERIKCDRPYARNDRIKDIAYPSTSHQNDGAFKKRDNSMQNRSGKGSSY
LEVKESPLPQETIDHNNQKQKKGKTKSQTLIKEHFIDRYVKTWGREGFFFLLLEMAYATP
SGYSEFLHKTTFYASCLISSQLSKTRMPEFLICIYYASFHMHERLVKLKVHTKNKKGNQN
CIPVLFINLLKTFFLKFYRAEIEALHSSGMTAVVKFSDYGNYEEVLLSNIRPIQAEAW
Download sequence
Identical sequences F7B4G6
ENSMODP00000007837 ENSMODP00000007837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]