SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007905 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007905
Domain Number 1 Region: 148-217
Classification Level Classification E-value
Superfamily Homeodomain-like 2.35e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 56-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000333
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 24-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000561
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007905
Domain Number - Region: 115-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0399
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007905   Gene: ENSMODG00000006371   Transcript: ENSMODT00000008065
Sequence length 390
Comment pep:known_by_projection chromosome:BROADO5:2:74271612:74340202:1 gene:ENSMODG00000006371 transcript:ENSMODT00000008065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQSSAVTTEGSVKGLPDILGVPMQQIPQCAGCNQHILDKFILKVLDRHWHGSCLKCADC
QMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRNRGGSKH
EKESSAEDCGVSDSELSFREDQILSDLGHTNRIYGNVGDVAGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSVSSLPSHTPLLNGLDYTMDSHLGIIAHGGQGVTQTLRVMAGGPT
SDISTGSSVGYPDFPTSPASWLDEMDHPPF
Download sequence
Identical sequences F7GCT5
13616.ENSMODP00000007905 ENSMODP00000007905 XP_001374523.3.35504 ENSMODP00000007905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]