SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007934 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007934
Domain Number 1 Region: 224-311
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-20
Family Canonical RBD 0.0035
Further Details:      
 
Domain Number 2 Region: 161-184
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000051
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007934   Gene: ENSMODG00000006398   Transcript: ENSMODT00000008096
Sequence length 422
Comment pep:novel chromosome:BROADO5:1:371625732:371627027:1 gene:ENSMODG00000006398 transcript:ENSMODT00000008096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSLGSNTYNRQNWEDSDFPILCQTCLGENPYVRMTKDIYGKACKICAKPFTVFRWCPG
VRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDVGLSLKDDMPKSDVNQEYYTQN
VEREISNSDGTRPVGLLGKATATSDMLLKLARTTPYYKRNHPHICSFWVKGECKRGEECP
YRHEKPTNPEDPLADQNIKDRYYAINDPVADKLLKRASTMPHLDPPDDKTITTLYVGGLG
DTISEADLRNHFYQFGEIRTITVVQRQHCAFIQFATRQAAEMAAEKSFNKLILNGRRLNV
KWGRSQAARGKEKEKEGTTDSGLKLEPVPGLPGALPPPPPPPTAEEASANYFNLPPSGLP
AVVNIALPPPSRIAPPSPPGFGPQVFHPMGPPPPFMPAPGPIHYPSQDPQRMGAHAGKHS
SS
Download sequence
Identical sequences F7FRP8
ENSMODP00000007934 ENSMODP00000007934 13616.ENSMODP00000007934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]