SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007999 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007999
Domain Number 1 Region: 4-519
Classification Level Classification E-value
Superfamily SIS domain 3.06e-180
Family Phosphoglucose isomerase, PGI 0.000000000000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007999   Gene: ENSMODG00000006446   Transcript: ENSMODT00000008162
Sequence length 520
Comment pep:novel chromosome:BROADO5:4:391072552:391074161:1 gene:ENSMODG00000006446 transcript:ENSMODT00000008162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATFTQDPNFLKLVQWHQKHGSELNLCCLFKTDQDRFSHFSLNLDTQNGQILVDYSKNLI
TGDVMKMLIELAKSQEVEKVQEEMFKGKKINFMEDQTVFHVALRNCSNTPMLVDGKDVVL
EVNKVLEKMKTFCERARGREWKGYSGKTITYVINIGIGGSDLGPLMVTEALKPYSKDDPH
VWFVSNIDGTHIAKTLAELNPETSLFIIASKMFTTQETITNSETAREWFLQEAKDAVAKH
SVALSTSAPKVKEFGIDTQNMFEFWDWVGGRYSLSIQAMERPIADHNHFLTTPLEWNAPV
VLETQALLPYDQNMHRFASYFQKGDMESNGKYITKSGARVNYNTGPIVWGEPGTNGQHAF
YQLIHQGTRMIPCDFLIPVQILNPTQNGLHHKILLANFLAQIEALMKGKTEEEAQKELEV
AGKSGDALKKLLPHKVFEGNHPTNSIVFTKLTPFILGTLIAMYEHKIFVQGVVWDVNSYD
QRGVELGKQLAKKIEPELDSDKPVTSHEASTNGLMNFIKK
Download sequence
Identical sequences F7EGH4
ENSMODP00000007999 13616.ENSMODP00000007999 ENSMODP00000007999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]