SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008002 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008002
Domain Number 1 Region: 211-278
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-23
Family RING finger domain, C3HC4 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008002   Gene: ENSMODG00000006450   Transcript: ENSMODT00000008165
Sequence length 329
Comment pep:known_by_projection chromosome:BROADO5:3:459422971:459478396:1 gene:ENSMODG00000006450 transcript:ENSMODT00000008165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASPQPGRYFCHCCSAEISPRLPDYICPRCESGFIEELPEETRNTENSSNSATAPTDQ
NRQPFENVDQHLFTLPQGYGQFAFGIFDDSFEFPTFGSGVQSEDARDSENRREREHQSRH
RYGARQPRARLTARRAAGRHEGVPTLEGIIQQLVNGIIAPATIPNLGLGPWGVLHSNPMD
YAWGANGLDAIITQLLNQFENTGPPPADKEKIQALPTIQVTEEHVGSGLECPVCKDDYTL
GENVRQLPCNHLFHDGCIVPWLEQHDTCPVCRKSLSGQNTATNPPGLTGMNFSSSSSSSS
SSSPIPNSSDGSREALSLLPIDGYHCAGL
Download sequence
Identical sequences F7FH24
ENSMODP00000008002 ENSMODP00000008002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]