SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008135 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008135
Domain Number 1 Region: 420-552
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-32
Family DEP domain 0.0000222
Further Details:      
 
Domain Number 2 Region: 244-367
Classification Level Classification E-value
Superfamily PDZ domain-like 6.26e-23
Family PDZ domain 0.0000309
Further Details:      
 
Domain Number 3 Region: 13-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.4e-23
Family DIX domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008135   Gene: ENSMODG00000006553   Transcript: ENSMODT00000008299
Sequence length 732
Comment pep:known_by_projection chromosome:BROADO5:2:255543031:255549326:1 gene:ENSMODG00000006553 transcript:ENSMODT00000008299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSAAGLGGAGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYYFKS
MDQDFGVVKEEISDDNARLPCFNGRVVLLGKLVSSDNPQPENTPQAPEPRAEPSSPPPPL
PPLPPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVISLRRDRSRRRESIDHVGGGH
RPNGSSRLERHLAGYESSSTLLTSELENTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHR
RRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIG
SIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLREIVHKPGPIVLTVKCWDPS
PQAYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAYPGSSSMSTITSGSSLPDGCEGRSLS
IHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKY
ASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAP
LPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYSYGGGSAGSQHSEGNRSSGSTRSD
GGIGRPGRPEDRGPESKSGSGSESEPSSRGGSLHWGGDSGDATPPPPRGLGGGGSSLRSH
PNLHPYGPPPGVALPYNPMMVVMMPPPPPPAVQPPGAPPVRDLGSVPPELTASRQSFHLA
MGNPSEFFVDVM
Download sequence
Identical sequences F7BUW7
ENSMODP00000008135 ENSMODP00000008135 13616.ENSMODP00000008135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]